#kaloriendefizit medias

Posts tagged on #kaloriendefizit

Top Posts Recent Posts

Top Posts

Der Sommer ist wieder da ☀️!
Habt ihr auch so tolles Wetter? Ich freu mich 😍.
Irgendwo unter den vielen Beeren verstecken sich zwei Kugeln Eis für nur 62 kcal 🍨. Es ist das Breyers delight Schoko und ich kann es echt empfehlen (Werbung selbst bezahlt). Ich wünsch euch einen schönen ☀️ Tag!.

Der Sommer ist wieder da ☀️! Habt ihr auch so tolles Wetter? Ich freu mich 😍. Irgendwo unter den vielen Beeren verstecken sich zwei Kugeln Eis für nur 62 kcal 🍨. Es ist das Breyers delight Schoko und ich kann es echt empfehlen (Werbung selbst bezahlt). Ich wünsch euch einen schönen ☀️ Tag! ...

Hallo meine Lieben 🥰
Nachdem ich gestern Abend zusammen mit ein paar Freundinnen gegrillt habe, fiel mein Defizit dementsprechend natürlich etwas geringer aus. Der Abend war aber super schön, das Essen total lecker und mir das Defizit am Ende des Tages dann auch mal egal. Auch das ist das Leben. 
Eine Abnahme wie meine ist zwar mehr eine komplette Lebensveränderung, dennoch sollte sie nicht alles in deinem Leben bestimmen. Sich mal was gönnen und auch mal fünfe gerade sein lassen sorgt auch mal für neue Motivation und tut der Seele gut. 👌🏻
Auf dem Bild seht ihr mein Abendbrot von heute, bei mir gab es heut recht spät Mittagessen und dementsprechend hat sich auch das Abendessen etwas nach hinten verschoben. Ich bin durch die Abnahme hinweg aber tendenziell eh eher eine Spätesserin geworden. 😄
Auf dem Bild seht ihr ein Eiweißtoastie (hab ich euch heute in der Story empfohlen 👌🏻) mit Hirtenkäse Aufstrich & Hähnchenbrust Aufschnitt. Dazu Gurke und Möhren, 60g Krautsalat und ein Geflügelwiener mit Ketchup light. Das ist eigentlich mein Standard Abendbrot, ich ess selten zwei mal am Tag warm und liebe Brotzeit 🤤
Außerdem macht es mir meine Wochenplanung leichter, weils abends eben immer das Gleiche gibt. 🙊
Wie sieht’s da bei euch aus? Esst ihr eher abends oder mittags warm? Und esst ihr auch eher später in den Abend rein, oder lieber früh?🧐
Genießt euren Abend, morgen ist die Woche dann schon wieder geschafft. 💪🏼😊.

Hallo meine Lieben 🥰 Nachdem ich gestern Abend zusammen mit ein paar Freundinnen gegrillt habe, fiel mein Defizit dementsprechend natürlich etwas geringer aus. Der Abend war aber super schön, das Essen total lecker und mir das Defizit am Ende des Tages dann auch mal egal. Auch das ist das Leben. Eine Abnahme wie meine ist zwar mehr eine komplette Lebensveränderung, dennoch sollte sie nicht alles in deinem Leben bestimmen. Sich mal was gönnen und auch mal fünfe gerade sein lassen sorgt auch mal für neue Motivation und tut der Seele gut. 👌🏻 Auf dem Bild seht ihr mein Abendbrot von heute, bei mir gab es heut recht spät Mittagessen und dementsprechend hat sich auch das Abendessen etwas nach hinten verschoben. Ich bin durch die Abnahme hinweg aber tendenziell eh eher eine Spätesserin geworden. 😄 Auf dem Bild seht ihr ein Eiweißtoastie (hab ich euch heute in der Story empfohlen 👌🏻) mit Hirtenkäse Aufstrich & Hähnchenbrust Aufschnitt. Dazu Gurke und Möhren, 60g Krautsalat und ein Geflügelwiener mit Ketchup light. Das ist eigentlich mein Standard Abendbrot, ich ess selten zwei mal am Tag warm und liebe Brotzeit 🤤 Außerdem macht es mir meine Wochenplanung leichter, weils abends eben immer das Gleiche gibt. 🙊 Wie sieht’s da bei euch aus? Esst ihr eher abends oder mittags warm? Und esst ihr auch eher später in den Abend rein, oder lieber früh?🧐 Genießt euren Abend, morgen ist die Woche dann schon wieder geschafft. 💪🏼😊 ...

Während das Abendessen auf dem Herd gerade noch vor sich hin brutzelt nutze ich den Moment um euch noch das Mittagessen von heute zu zeigen: eine Kollegin hat heute ihren Einstand gemacht, daher gab es Partybrezel und etwas Gurke ❤
Später dann noch ein Stück Apfelkuchen 😁🤤
Nach der Arbeit ging es für mich noch zum Sport und jetzt steht das GNTM-Finale an 😂

#mittagessen #kalorienzählen #caloriecounting #kaloriendefizit #abnehmreise #abnehmen #abnehmmotivation #abnehmen2019 #weightloss #weightlossjourney #gewichtverlieren #abnehmtagebuch #ernährungstagebuch #ernährungsumstellung #food #foodblogger #healthyfood #healthy #healthybreakfast #transformation #fitfam #gesundabnehmen #abnehmenmitgenuss #gesundeernährung #gesundessen #fitmitina2019.

Während das Abendessen auf dem Herd gerade noch vor sich hin brutzelt nutze ich den Moment um euch noch das Mittagessen von heute zu zeigen: eine Kollegin hat heute ihren Einstand gemacht, daher gab es Partybrezel und etwas Gurke ❤ Später dann noch ein Stück Apfelkuchen 😁🤤 Nach der Arbeit ging es für mich noch zum Sport und jetzt steht das GNTM-Finale an 😂 #mittagessen #kalorienz ählen #caloriecounting #kaloriendefizit #abnehmreise #abnehmen #abnehmmotivation #abnehmen2019 #weightloss #weightlossjourney #gewichtverlieren #abnehmtagebuch #ern ährungstagebuch #ern ährungsumstellung #food #foodblogger #healthyfood #healthy #healthybreakfast #transformation #fitfam #gesundabnehmen #abnehmenmitgenuss #gesundeern ährung #gesundessen #fitmitina2019 ...

Hähnchen-Ananas-Curry mit Möhren und Zuckerschoten
.
Zeit für ein neues Rezept! Am Wochenende hatte ich Lust auf irgendwas mit Reis, also gabs eine neue Curry-Variation mit Hähnchenfilet, Ananas und einer kleinen Gemüseeinlage aus Mähren und Zuckerschoten. Alles mit einem guten Schluck Kokosmilch und passenden Gewürzen eingekocht und fertig war irgendwas mit Reis. Hier kommt das Rezept: .
➡️Zutaten für 3 Portionen: 
400g Hähnchenfilet 
150g Jasminreis
500ml Wasser
10g Butter
3 Möhren
1 Dose Kokosmilch, fettarm 
1 Dose Ananas, gestückelt 
150g Zuckerschoten 
3 EL Tomatenmark 
1 TL Curry, 1 TL Kurkuma, 1 TL Paprikapulver 
1/2 TL Knoblauchpulver, 1/2 TL Koriander
1/2 Zitrone 
Salz, Pfeffer
.
➡️Rezept: 
1.) Das Hähnchenfilet in Stücke schneiden und in der Butter in einem Topf scharf anbraten. Mit Salz und Pfeffer würzen. Anschließend herausnehmen und beiseite stellen. Den Reis nach Packungsanleitung kochen. 
2.) Die Möhren schälen und in kleine Scheiben schneiden, anschließend im Sud des Hähnchens mit 500ml Wasser aufkochen und das Wasser reduzieren lassen. Mit Kokosmilch ablöschen und Tomatenmark unterrühren. 
3.) Die Zuckerschoten waschen und zusammen mit den Ananasstücken unterrühren. Curry, Kurkuma, Koriander und Paprikapulver hinzugeben. Zuletzt das Hähnchen unterrühren. Den Saft einer halben Zitrone hineingeben und alles mit Salz und Pfeffer abschmecken. .
➡️Nährwertangaben pro Portion: 
Calories: 551
Protein: 40g
Fat: 15g
Carbs: 64g

______________________________________________
#curry #hähnchencurry #ananascurry #currychicken #curryrezept #rezepte #rezept #currymitreis #jasminreis #kalorienzählen #kalorientracken #kalorienarmesessen #kaloriendefizit.

Hähnchen-Ananas-Curry mit Möhren und Zuckerschoten . Zeit für ein neues Rezept! Am Wochenende hatte ich Lust auf irgendwas mit Reis, also gabs eine neue Curry-Variation mit Hähnchenfilet, Ananas und einer kleinen Gemüseeinlage aus Mähren und Zuckerschoten. Alles mit einem guten Schluck Kokosmilch und passenden Gewürzen eingekocht und fertig war irgendwas mit Reis. Hier kommt das Rezept: . ➡️Zutaten für 3 Portionen: 400g Hähnchenfilet 150g Jasminreis 500ml Wasser 10g Butter 3 Möhren 1 Dose Kokosmilch, fettarm 1 Dose Ananas, gestückelt 150g Zuckerschoten 3 EL Tomatenmark 1 TL Curry, 1 TL Kurkuma, 1 TL Paprikapulver 1/2 TL Knoblauchpulver, 1/2 TL Koriander 1/2 Zitrone Salz, Pfeffer . ➡️Rezept: 1.) Das Hähnchenfilet in Stücke schneiden und in der Butter in einem Topf scharf anbraten. Mit Salz und Pfeffer würzen. Anschließend herausnehmen und beiseite stellen. Den Reis nach Packungsanleitung kochen. 2.) Die Möhren schälen und in kleine Scheiben schneiden, anschließend im Sud des Hähnchens mit 500ml Wasser aufkochen und das Wasser reduzieren lassen. Mit Kokosmilch ablöschen und Tomatenmark unterrühren. 3.) Die Zuckerschoten waschen und zusammen mit den Ananasstücken unterrühren. Curry, Kurkuma, Koriander und Paprikapulver hinzugeben. Zuletzt das Hähnchen unterrühren. Den Saft einer halben Zitrone hineingeben und alles mit Salz und Pfeffer abschmecken. . ➡️Nährwertangaben pro Portion: Calories: 551 Protein: 40g Fat: 15g Carbs: 64g ______________________________________________ #curry #h ähnchencurry #ananascurry #currychicken #curryrezept #rezepte #rezept #currymitreis #jasminreis #kalorienz ählen #kalorientracken #kalorienarmesessen #kaloriendefizit ...

Hallo ihr Lieben 💕💕💕
Bei mir gibt es heute eine Bowl aus Salat, Gurke, Tomate, Karotte, gebratener Zucchini, Reis, Vegi Fleisch und Edamame.
Das Ganze hat 385 Kalorien.
Ich wünsch euch einen schönen Abend! 💕.

Hallo ihr Lieben 💕💕💕 Bei mir gibt es heute eine Bowl aus Salat, Gurke, Tomate, Karotte, gebratener Zucchini, Reis, Vegi Fleisch und Edamame. Das Ganze hat 385 Kalorien. Ich wünsch euch einen schönen Abend! 💕 ...

Guten Tag meine Lieben ♥️ heutiges Thema: Fitness zur Gewohnheit machen. Neun einfache Schritte, die du zu befolgen kannst und dir weiter helfen können. 
1) iss nicht zu wenig Kalorien. Berechne deine Kalorienmenge und iss nach dem Ergebnis. Zu wenig heißt nicht gleich besseres Ergebnis. 2) zwing dich nicht irgendwas zu essen nur weil du denkst es sei gesund , iss das was dir schmeckt. 3) hör auf dir alles zu verbieten. Ab und zu etwas zu naschen schadet dir nicht. Übertreib es aber nicht gleich. 4) trainier so wie es für dich am besten ist aber seh es nicht als Strafe oder zwang an. Trainier deine Lieblingsübungen 5) mach dir einen Plan und setzte ihn um! 6) ein wenig ist besser als nichts.. es ist besser wenn du 2 mal ins Fitness gehst pro Woche anstatt garnicht , step by step , mach dir keinen Druck. Nach einer Zeit gehst du 3-4 mal in der Woche und das ohne Probleme. 7) schlafen ist Mega wichtig für die Regeneration , 7-8 h am Tag wäre gut  8) halte den Fokus auf dich. Du bist wichtig , achte nicht auf den Rest. 9) und zu guter letzt, das aller wichtigste dabei ist Spaß zu haben und es zu genießen, genieße deine Fortschritte , dadurch kriegst du noch viel mehr Motivation und Wirst glücklicher 🔥🙏🏽♥️ #twobrothersarmy #kalorien #kraftsport #kaloriendefizit #fettabbau #muskelnaufbauen #diätmotivation #muskeln #abgerechnetwirdamstrand #fitfamgermany #abnehmen2019 #eiweiß #ernährungsumstellung #muskel #ernährungsplan #muskelaufbau #abnehmtagebuch #ernährung #kassel #Frankfurt #Berlin #Köln #Stuttgart #münchen #Hamburg #Heilbronn #abnehmmotivation #fettverbrennung #ziele.

Guten Tag meine Lieben ♥️ heutiges Thema: Fitness zur Gewohnheit machen. Neun einfache Schritte, die du zu befolgen kannst und dir weiter helfen können. 1) iss nicht zu wenig Kalorien. Berechne deine Kalorienmenge und iss nach dem Ergebnis. Zu wenig heißt nicht gleich besseres Ergebnis. 2) zwing dich nicht irgendwas zu essen nur weil du denkst es sei gesund , iss das was dir schmeckt. 3) hör auf dir alles zu verbieten. Ab und zu etwas zu naschen schadet dir nicht. Übertreib es aber nicht gleich. 4) trainier so wie es für dich am besten ist aber seh es nicht als Strafe oder zwang an. Trainier deine Lieblingsübungen 5) mach dir einen Plan und setzte ihn um! 6) ein wenig ist besser als nichts.. es ist besser wenn du 2 mal ins Fitness gehst pro Woche anstatt garnicht , step by step , mach dir keinen Druck. Nach einer Zeit gehst du 3-4 mal in der Woche und das ohne Probleme. 7) schlafen ist Mega wichtig für die Regeneration , 7-8 h am Tag wäre gut 8) halte den Fokus auf dich. Du bist wichtig , achte nicht auf den Rest. 9) und zu guter letzt, das aller wichtigste dabei ist Spaß zu haben und es zu genießen, genieße deine Fortschritte , dadurch kriegst du noch viel mehr Motivation und Wirst glücklicher 🔥🙏🏽♥️ #twobrothersarmy #kalorien #kraftsport #kaloriendefizit #fettabbau #muskelnaufbauen #di ätmotivation #muskeln #abgerechnetwirdamstrand #fitfamgermany #abnehmen2019 #eiwei ß #ern ährungsumstellung #muskel #ern ährungsplan #muskelaufbau #abnehmtagebuch #ern ährung #kassel #Frankfurt #Berlin #K öln #Stuttgart #m ünchen #Hamburg #Heilbronn #abnehmmotivation #fettverbrennung #ziele ...

Käsekuchen 😍
Bei uns gab es heute wieder einen kleinen Käsekuchen 💕. Ich habe den Kuchen in einer 12er Form gebacken und der ganze Kuchen hat 244 Kalorien ☺️.
💕💕💕REZEPT 💕💕💕
75g Frischkäse light
100g Magerquark oder Skyr
25g Erytrit 
1 kleines Ei 
5g Speisestärke
Frischkäse, Quark, Stärke und Xucker glatt rühren. 
Das Ei dazu geben und gut verrühren. 
Bei 160 Grad Umluft 35 min backen. 
Den Kuchen aus dem Ofen nehmen und kalt werden lassen!.

Käsekuchen 😍 Bei uns gab es heute wieder einen kleinen Käsekuchen 💕. Ich habe den Kuchen in einer 12er Form gebacken und der ganze Kuchen hat 244 Kalorien ☺️. 💕💕💕REZEPT 💕💕💕 75g Frischkäse light 100g Magerquark oder Skyr 25g Erytrit 1 kleines Ei 5g Speisestärke Frischkäse, Quark, Stärke und Xucker glatt rühren. Das Ei dazu geben und gut verrühren. Bei 160 Grad Umluft 35 min backen. Den Kuchen aus dem Ofen nehmen und kalt werden lassen! ...

Hallo Krieger des Lebens 🙏🏽🙂🔥 Welche Lebensmittel sind eure Diät Retter ? Sattmacher? In die Kommentare damit ⬇️ 6 LEBENSMITTEL, die deine Diät einfacher machen können in dem sie dich satt machen !! ‼️🔥🙏🏽 1. Eier 🍳, sind eiweißreich und super schnell und einfach zuzubereiten. 
2. Joghurt 🍧eiweißreich, wenig Kalorien, wenig KH und wenig Fett. 
3. Gemüse 🌽 ist super. Am besten zu jeder Mahlzeit eine Handvoll Gemüse essen. Hat wenig Kalorien und dadurch kann man große Mengen davon essen. Perfekt zum Hähnchen als Beispiel. 
4. Magerquark. Wenig Kalorien und viel Eiweiß. Ein Tipp: Magerquark mit Wasser mischen und Geschmack oder Whey rein, leckere Beeren oder anderes Obst Dazu, alles Zsm mischen und guten Appetit. 
5. Kartoffeln 🥔, machen super satt, geben dir Energie und sind einfach zuzubereiten. 
6. Hähnchen 🍗 , eiweißreich und kann man in verschiedenen Kombinationen essen. Zum Beispiel Salat mit Hähnchen 🥗, im Wrap 🌯 , usw.. Ich hoffe der Beitrag hilft euch weiter und hat euch gefallen. 
Wünsche euch allen einen schönen Tag ♥️🙏🏽🔥 Kommentiere dein Lieblingslebensmittel in der Diät ☺️⤵️ #twobrothersarmy #kalorien #kraftsport #kaloriendefizit #fettabbau #muskelnaufbauen #diätmotivation #muskeln #abgerechnetwirdamstrand #fitfamgermany #abnehmen2019 #eiweiß #ernährungsumstellung #muskel #ernährungsplan #muskelaufbau #abnehmtagebuch #ernährung #kassel #Frankfurt #Berlin #Köln #Stuttgart #münchen #Hamburg #Heilbronn #abnehmmotivation #fettverbrennung #sattmacher.

Hallo Krieger des Lebens 🙏🏽🙂🔥 Welche Lebensmittel sind eure Diät Retter ? Sattmacher? In die Kommentare damit ⬇️ 6 LEBENSMITTEL, die deine Diät einfacher machen können in dem sie dich satt machen !! ‼️🔥🙏🏽 1. Eier 🍳, sind eiweißreich und super schnell und einfach zuzubereiten. 2. Joghurt 🍧eiweißreich, wenig Kalorien, wenig KH und wenig Fett. 3. Gemüse 🌽 ist super. Am besten zu jeder Mahlzeit eine Handvoll Gemüse essen. Hat wenig Kalorien und dadurch kann man große Mengen davon essen. Perfekt zum Hähnchen als Beispiel. 4. Magerquark. Wenig Kalorien und viel Eiweiß. Ein Tipp: Magerquark mit Wasser mischen und Geschmack oder Whey rein, leckere Beeren oder anderes Obst Dazu, alles Zsm mischen und guten Appetit. 5. Kartoffeln 🥔, machen super satt, geben dir Energie und sind einfach zuzubereiten. 6. Hähnchen 🍗 , eiweißreich und kann man in verschiedenen Kombinationen essen. Zum Beispiel Salat mit Hähnchen 🥗, im Wrap 🌯 , usw.. Ich hoffe der Beitrag hilft euch weiter und hat euch gefallen. Wünsche euch allen einen schönen Tag ♥️🙏🏽🔥 Kommentiere dein Lieblingslebensmittel in der Diät ☺️⤵️ #twobrothersarmy #kalorien #kraftsport #kaloriendefizit #fettabbau #muskelnaufbauen #di ätmotivation #muskeln #abgerechnetwirdamstrand #fitfamgermany #abnehmen2019 #eiwei ß #ern ährungsumstellung #muskel #ern ährungsplan #muskelaufbau #abnehmtagebuch #ern ährung #kassel #Frankfurt #Berlin #K öln #Stuttgart #m ünchen #Hamburg #Heilbronn #abnehmmotivation #fettverbrennung #sattmacher ...

Ein kleiner Apfelcrumble ganz für mich alleine 😍
Er ist super schnell gemacht, hat nur 96 kcal und mein Bedürfnis nach Kuchen ist voll befriedigt. ☺️
Das Rezept ergibt zwei Portionen. 💕💕💕REZEPT 💕💕💕
Einen Apfel aufschneiden und in zwei kleine Förmchen schichten. (Meine sind etwa so groß wie ein Unterteller. )
Je mit etwa einem TL Erytrit oder Zucker etc. Und etwas Zimt bestreuen und die Streusel drauf geben. 
Für die Streusel 25g Mehl mit 10g kalter Butter (light) und 10g Erytrit mischen bis Streusel entstehen. Am besten mit den Händen kneten. 
Streusel auf den Apfel geben und bei 180 Grad  25-30 min backen, bis die Streusel Farbe haben..

Ein kleiner Apfelcrumble ganz für mich alleine 😍 Er ist super schnell gemacht, hat nur 96 kcal und mein Bedürfnis nach Kuchen ist voll befriedigt. ☺️ Das Rezept ergibt zwei Portionen. 💕💕💕REZEPT 💕💕💕 Einen Apfel aufschneiden und in zwei kleine Förmchen schichten. (Meine sind etwa so groß wie ein Unterteller. ) Je mit etwa einem TL Erytrit oder Zucker etc. Und etwas Zimt bestreuen und die Streusel drauf geben. Für die Streusel 25g Mehl mit 10g kalter Butter (light) und 10g Erytrit mischen bis Streusel entstehen. Am besten mit den Händen kneten. Streusel auf den Apfel geben und bei 180 Grad 25-30 min backen, bis die Streusel Farbe haben. ...

Most Recent

Noch zu später Stunde ein Bild von unserem Mittagessen. 😍 Kartoffelspalten mit Blumenkohl, Bratwurst und Hollondaise. ❤️❤️❤️Es war köstlich
Um das wieder an zu trainieren hab ich auch gleich 2xRasen gemäht. 16.000 Schritte waren heute drin. Meine Knie schmerzen aber egal. Das Wetter war so klasse das mussten wir heute ausnutzen.
Ich Falle jetzt ins Bett. Gute Nacht meine Lieben. 😘
.
.
.
.
#leckeressen #lecker #tasty #delicious #food #foodphotography #foodstagram #foodblogger #healthy #healthylifestyle #healthyfood #healthydinner #healthyrecipes #keto #getmybodyback #gesundesessen #gesundeernährung #gesundleben #fitmom #fitgirl #weightloss #fitnessfood #fitnessmotivation #kaloriendefizit #weightwatch #momblogger #momof2boys #abendessen #dinner #lunch.

Noch zu später Stunde ein Bild von unserem Mittagessen. 😍 Kartoffelspalten mit Blumenkohl, Bratwurst und Hollondaise. ❤️❤️❤️Es war köstlich Um das wieder an zu trainieren hab ich auch gleich 2xRasen gemäht. 16.000 Schritte waren heute drin. Meine Knie schmerzen aber egal. Das Wetter war so klasse das mussten wir heute ausnutzen. Ich Falle jetzt ins Bett. Gute Nacht meine Lieben. 😘 . . . . #leckeressen #lecker #tasty #delicious #food #foodphotography #foodstagram #foodblogger #healthy #healthylifestyle #healthyfood #healthydinner #healthyrecipes #keto #getmybodyback #gesundesessen #gesundeern ährung #gesundleben #fitmom #fitgirl #weightloss #fitnessfood #fitnessmotivation #kaloriendefizit #weightwatch #momblogger #momof2boys #abendessen #dinner #lunch ...

Die Konferenz ist vorbei. Insgesamt war es sehr anstrengend, ich hab mich wenig bewegt und leider wahrscheinlich auch zu viel gegessen.
Ich gehe mal davon aus, dass es diese Woche nichts mit einer Abnahme wird. #lenassommer
Morgen geht's trotz allem wieder weiter mit #kalorienzählen und #sport 
#abnehmen #abnehmen2019 #wegmitdemfett #wegmitdemspeck #weightloss #kalorienüberschuss #kalorienverbrauchen #kaloriendefizit #kalorien #gesundessen #gesundleben #gewichtsreduktion #gewichtsverlust #gewichtverlieren #gesundeernährung.

Die Konferenz ist vorbei. Insgesamt war es sehr anstrengend, ich hab mich wenig bewegt und leider wahrscheinlich auch zu viel gegessen. Ich gehe mal davon aus, dass es diese Woche nichts mit einer Abnahme wird. #lenassommer Morgen geht's trotz allem wieder weiter mit #kalorienz ählen und #sport #abnehmen #abnehmen2019 #wegmitdemfett #wegmitdemspeck #weightloss #kalorien überschuss #kalorienverbrauchen #kaloriendefizit #kalorien #gesundessen #gesundleben #gewichtsreduktion #gewichtsverlust #gewichtverlieren #gesundeern ährung ...

Bananen muffins 🍌
Super lecker und nur 129 kcal pro Muffin!

Für 12 muffins benötigt ihr: 
2 reife Bananen 
2 eier
35g kokosnussöl 
180g Weizen oder dinkelmehl 
1 Schuss Milch 
30g Honig 
Halbe Packung Backpulver 
Alles zu einem Teig mischen und in 12 muffinförmchen geben. Am besten silikonförmchen, da sie an Papier kleben.

Bananen muffins 🍌 Super lecker und nur 129 kcal pro Muffin! Für 12 muffins benötigt ihr: 2 reife Bananen 2 eier 35g kokosnussöl 180g Weizen oder dinkelmehl 1 Schuss Milch 30g Honig Halbe Packung Backpulver Alles zu einem Teig mischen und in 12 muffinförmchen geben. Am besten silikonförmchen, da sie an Papier kleben ...

Mein früheres ich hätte heute eine tolle Ausrede gefunden, um nicht laufen zu gehen, zum Beispiel:

Mein früheres ich hätte heute eine tolle Ausrede gefunden, um nicht laufen zu gehen, zum Beispiel: "Es ist schon dunkel" oder "Die 10.000 Schritte sind voll, das reicht" Aber ich hatte nachdem mein Sohn im Bett war so eine Energie in mir, dass ich einfach laufen gehen musste. Was soll ich sagen, Wahnsinn was es bewirkt, wenn es endlich Klick gemacht hat 😊 Unbezahlte Werbung #abnehmen2019 #aufdenk örperhören #abnehmenmityazio #abnehmen #fitbitcharge2 #fitbit #fitwerden #kalorienz ählenmityazio #yazio #kalorienz ählen #kaloriendefizit ...

Werbung, unbezahlt | Das Bild ist natürlich nicht von heute, denn leider war ich heute nicht mit Paula 🐶 unterwegs und über meinen Lauf habe ich mich auch nicht gefreut 🙈
Ich war mal wieder motiviert laufen zu gehen und fühlte mich echt gut, aber nach 1km taten mir so die Schienbeine weh und waren quasi taub, sodass ich nicht mehr richtig die Füße anheben und laufen konnte. Daraus wurden dann mehrere Pausen, inklusive auf einer Parkbank sitzen, wo ich vergessen habe auf der Uhr zu pausieren 🤦🏻‍♀️ am Ende bin ich dann im Wechsel zurück nach Hause gelaufen und gegangen und habe mir erstmal Magnesium Tabletten geholt. Die haben nämlich schon mal geholfen, als ich solche Schmerzen beim Laufen hatte. Drückt mir die Daumen, dass es dieses Mal auch so ist, denn nächsten Freitag ist schon der Abendlauf, wo ich mitmache 🏃🏻‍♀️ Aber es kann ja jedenfalls nur besser werden als heute 🙊 .
.
#lenassommer #kalorienzählen #diättagebuch #kaloriendefizit #gesundeernährung #abnehmen #abnehmen2019 #abnehmtagebuch #ernährungstagebuch #liveitliftit #teamliveitliftit #diät #motivation #foodie #foodblog #balanceisthekey #leichterwerden #ernährungsumstellung #abnehmenohneverzicht #abnehmenohnehungern #laufen #laufliebe #laufanfänger #workout #sport #bewegung #läufer #instarunners #fitwerden #fitstattfett.

Werbung, unbezahlt | Das Bild ist natürlich nicht von heute, denn leider war ich heute nicht mit Paula 🐶 unterwegs und über meinen Lauf habe ich mich auch nicht gefreut 🙈 Ich war mal wieder motiviert laufen zu gehen und fühlte mich echt gut, aber nach 1km taten mir so die Schienbeine weh und waren quasi taub, sodass ich nicht mehr richtig die Füße anheben und laufen konnte. Daraus wurden dann mehrere Pausen, inklusive auf einer Parkbank sitzen, wo ich vergessen habe auf der Uhr zu pausieren 🤦🏻‍♀️ am Ende bin ich dann im Wechsel zurück nach Hause gelaufen und gegangen und habe mir erstmal Magnesium Tabletten geholt. Die haben nämlich schon mal geholfen, als ich solche Schmerzen beim Laufen hatte. Drückt mir die Daumen, dass es dieses Mal auch so ist, denn nächsten Freitag ist schon der Abendlauf, wo ich mitmache 🏃🏻‍♀️ Aber es kann ja jedenfalls nur besser werden als heute 🙊 . . #lenassommer #kalorienz ählen #di ättagebuch #kaloriendefizit #gesundeern ährung #abnehmen #abnehmen2019 #abnehmtagebuch #ern ährungstagebuch #liveitliftit #teamliveitliftit #di ät #motivation #foodie #foodblog #balanceisthekey #leichterwerden #ern ährungsumstellung #abnehmenohneverzicht #abnehmenohnehungern #laufen #laufliebe #laufanf änger #workout #sport #bewegung #l äufer #instarunners #fitwerden #fitstattfett ...

nach dem erfolgreichen Training solch Bild am Himmel zu finden ist schon echt was feines... Letzte Woche war ich absolut #unzufriedenmitdergesamtsituation... nicht nur das es mit dem #sport nicht lief es war allgemein echt mies... Ich war eigentlich #dauermüde nicht nur körperlich sondern auch geistig mir war alles irgendwie zu viel Meine Lust irgendwas zu machen war unterirdisch... Am Wochenende gab's dann eine kleine aber Feine Auszeit in Form eines Besuches des #olympiastadion in Berlin und auch wenn es eine Klatsche gab für Hertha so tat mir der Tag unheimlich gut... Ich hab unheimlich Kraft mitgenommen und es genossen mal ohne die Kids unterwegs zu sein... gefehlt haben sie mir trotzdem irgendwie aber es war Notwendig... Am Montag bin ich frisch #motiviert in die neue Woche gestartet und hab wieder durchgezogen sowohl das #kalorienzählen als auch das #schrittziel und das Training heute 🙏 klar Ärger ich mich das ich es letzte Woche hab schleifen lassen und die Waage prompt die Quittung gezeigt hat aber ich bin #stolzaufmich das ich es dafür die Woche wieder #durchziehe... Auf jedes Hoch kommen Tiefs und um gedreht wichtig ist nur man muss nach Dem Tief den #arschhochkriegen und weiter machen 😉 und manchmal wird man dann auch mit einer tollen #abendstimmung belohnt 😍
#soistdasleben #nichtimmerfriedefreudeeierkuchen #dranbleibenlohntsich #kampfgegendieschwangerschaftskilos #motivationistwiederda #kaloriendefizit #schrittzähler #fitbit #altahr #abendrot #akkusaufladen #seelenwärmer.

nach dem erfolgreichen Training solch Bild am Himmel zu finden ist schon echt was feines... Letzte Woche war ich absolut #unzufriedenmitdergesamtsituation ... nicht nur das es mit dem #sport nicht lief es war allgemein echt mies... Ich war eigentlich #dauerm üde nicht nur körperlich sondern auch geistig mir war alles irgendwie zu viel Meine Lust irgendwas zu machen war unterirdisch... Am Wochenende gab's dann eine kleine aber Feine Auszeit in Form eines Besuches des #olympiastadion in Berlin und auch wenn es eine Klatsche gab für Hertha so tat mir der Tag unheimlich gut... Ich hab unheimlich Kraft mitgenommen und es genossen mal ohne die Kids unterwegs zu sein... gefehlt haben sie mir trotzdem irgendwie aber es war Notwendig... Am Montag bin ich frisch #motiviert in die neue Woche gestartet und hab wieder durchgezogen sowohl das #kalorienz ählen als auch das #schrittziel und das Training heute 🙏 klar Ärger ich mich das ich es letzte Woche hab schleifen lassen und die Waage prompt die Quittung gezeigt hat aber ich bin #stolzaufmich das ich es dafür die Woche wieder #durchziehe ... Auf jedes Hoch kommen Tiefs und um gedreht wichtig ist nur man muss nach Dem Tief den #arschhochkriegen und weiter machen 😉 und manchmal wird man dann auch mit einer tollen #abendstimmung belohnt 😍 #soistdasleben #nichtimmerfriedefreudeeierkuchen #dranbleibenlohntsich #kampfgegendieschwangerschaftskilos #motivationistwiederda #kaloriendefizit #schrittz ähler #fitbit #altahr #abendrot #akkusaufladen #seelenw ärmer ...